easygardening.sitew.org rapport :   Visitez le site


Titre:easy-gardening - page 1

La description :fast, easy and free create your website now i create my website free website created on site w easy-gardening page 1 buying seeds for your garden online many people like the challenge of raising plant...

Classement Alexa Global: # 612,471

Server:SiteW Webserver 1.2....

L'adresse IP principale: 188.165.156.234,Votre serveur France,Roubaix ISP:OVH SAS  TLD:org Code postal:fr

Ce rapport est mis à jour en 30-Sep-2018

Created Date:2010-03-29

Données techniques du easygardening.sitew.org


Geo IP vous fournit comme la latitude, la longitude et l'ISP (Internet Service Provider) etc. informations. Notre service GeoIP a trouvé l'hôte easygardening.sitew.org.Actuellement, hébergé dans France et son fournisseur de services est OVH SAS .

Latitude: 50.69421005249
Longitude: 3.1745600700378
Pays: France (fr)
Ville: Roubaix
Région: Nord-Pas-de-Calais
ISP: OVH SAS

the related websites

domaine Titre
easygardening.sitew.org easy-gardening - page 1
knudsenrobles0.qowap.com organic gardening produced easy through these tips - homepage
elliotfdwph.free-blogz.com 5 easy facts about business web page design described - homepage
bildeguy5.uzblog.net assisting you figure out web page design with one of these easy tips - homepage
gardening.cabanova.com gardening
ambragarlaschelli.carbonmade.com gardening design
organicgardeningtipspfwm.envision-web.com organic gardening
thesound-of-rain.tumblr.com gardening blog
organicgardeninguvzx.metablogs.net organic gardening blog
borkslater41.affiliatblogger.com not certain how to go about gardening? these guidelines can help! - homepage
gardeningtips.hatenablog.com gardening tips and advice
gardeningtipsofpw.blogger-news.net organic gardening tips
mcgrath34hoffmann.amoblog.com top six suggestions for gardening - homepage
duffy43foldager.fitnell.com not certain how to go about gardening? these tips can aid! - homepage
organicgroup.freeforums.net the organic gardening community invites you!

Analyse d'en-tête HTTP


Les informations d'en-tête HTTP font partie du protocole HTTP que le navigateur d'un utilisateur envoie à appelé SiteW Webserver 1.2.0 contenant les détails de ce que le navigateur veut et acceptera de nouveau du serveur Web.

X-Request-Id:5bc2d22d-f961-4881-a482-8cd2af857674
X-XSS-Protection:1; mode=block
Content-Language:en
X-Content-Type-Options:nosniff
Content-Encoding:gzip
Transfer-Encoding:chunked
Set-Cookie:_sw_session=eFg4TFZ6c3lVQ0ErMFRERVk3eUl4cXZtYlhmc0JlbWNDNExMOTRleUxrVXAycUovS2dYNnJ1cjNLZllHamJaUXgzeHJpWUpNNmsyYUFNczhPNmJDQVU5bnp4cWhETUZBUSt3TWNaSHB1Y2pLTktBVUl6QkQwOFFZYW5pY0VrcVVtNHRxVHFlNVI2aG11dGREei9oZUtIdmhXS2pUcDBTYXJWTWRZQTRQdGY1Yk5PQnJJTW5MUmQ2U29HcEt5VVlaRVdmZGMyS3pIYzZGZ2srdC9teW1HcGt5YTQwb2VpT29yaVZOVmxaVDI1dz0tLUhMei8vUzhuTlZwUVJLZno1Vzk5Z3c9PQ%3D%3D--e6ba4c9c506999e7e1bb10bfe26baedf832f2972; path=/; HttpOnly
X-Runtime:0.024484
Server:SiteW Webserver 1.2.0
Connection:keep-alive
X-UA-Compatible:chrome=1
Cache-Control:max-age=0, private, must-revalidate
Date:Sat, 29 Sep 2018 22:46:34 GMT
Content-Type:text/html; charset=utf-8

DNS

ipv4:IP:188.165.156.234
ASN:16276
OWNER:OVH, FR
Country:FR

HtmlToText

fast, easy and free create your website now i create my website free website created on site w easy-gardening page 1 buying seeds for your garden online many people like the challenge of raising plants and flowers from seeds. while it can be easier to stop by the local gardening center and purchase plants that are already growing, many gardeners truly enjoy the prospect and challenge of raising plants and vegetables for their gardens from seeds. perhaps you are a person who is interested in growing flowers and vegetables for your own garden spaces from seeds. if that is the case, you may be wondering what resources are available to you through which you can order seeds for garden plants, seeds for flowering plants and vegetables for your gardens. as with so many things in the 21st century, the internet and world wide web is proving to be a truly wonderful resource for people who are interested in growing their own plants from seed. at this point in time, there is a wide array of different types of websites through which consumers such as you can actually purchase seeds for your own gardens, including seeds for flowering and for vegetable plants. there are now some more generalized websites on the net through which you can by all types of seeds. for example, there are sites that are in business to offer men and women seeds at discounted prices. at the other end of the spectrum, there are website operations that have been established to provide people with some more high end (and more expensive) products. because many people have become interested in more specific types of gardening — for example, organic gardening — there are now websites that cater to some of these more specialized areas of gardening. for example, if you are interested in organic vegetable gardening, you will want to consider stopping by one or another of the sites that deal specifically in the selling or organic vegetable seeds. by way of another example, there are some people who are interested in crafting and creating beautiful flower gardens. to this end, there are innumerable websites on the net that deal with the selling of seeds for people interested in growing flowers. indeed, there are sites that are committed specifically to selling seeds for specific kinds of flowers. finally, there are information resources on the net that can provide you with authoritative information on a wide array of different issues dealing with gardening. in both the short and the long term, you can learn a great deal about gardening practices from these useful websites. next article : indoor gardening information ☖ ☐ | this website was created with sitew | create a website for free → this website will not work properly since javascript is disabled in your browser.

Informations Whois


Whois est un protocole qui permet d'accéder aux informations d'enregistrement.Vous pouvez atteindre quand le site Web a été enregistré, quand il va expirer, quelles sont les coordonnées du site avec les informations suivantes. En un mot, il comprend ces informations;

Domain Name: SITEW.ORG
Registry Domain ID: D158724931-LROR
Registrar WHOIS Server:
Registrar URL: http://www.ovh.com
Updated Date: 2017-03-12T02:39:08Z
Creation Date: 2010-03-29T14:52:23Z
Registry Expiry Date: 2018-03-29T14:52:23Z
Registrar Registration Expiration Date:
Registrar: OVH
Registrar IANA ID: 433
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C190531475-LROR
Registrant Name: Fabien VERSANGE
Registrant Organization: SiteW.COM
Registrant Street: 12, Le puech
Registrant City: Calvinet
Registrant State/Province:
Registrant Postal Code: 15340
Registrant Country: FR
Registrant Phone: +33.471436642
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: 7wjxokme2b88uhas1ncd@d.o-w-o.info
Registry Admin ID: C190531476-LROR
Admin Name: Fabien VERSANGE
Admin Organization: SiteW.COM SARL
Admin Street: 4, Place de l'Eglise
Admin City: YOLET
Admin State/Province:
Admin Postal Code: 15130
Admin Country: FR
Admin Phone: +33.972526092
Admin Phone Ext:
Admin Fax: +33.675237706
Admin Fax Ext:
Admin Email: wpix3q0f249pt5u8nbhq@b.o-w-o.info
Registry Tech ID: C190531476-LROR
Tech Name: Fabien VERSANGE
Tech Organization: SiteW.COM SARL
Tech Street: 4, Place de l'Eglise
Tech City: YOLET
Tech State/Province:
Tech Postal Code: 15130
Tech Country: FR
Tech Phone: +33.972526092
Tech Phone Ext:
Tech Fax: +33.675237706
Tech Fax Ext:
Tech Email: wpix3q0f249pt5u8nbhq@b.o-w-o.info
Name Server: DNS200.ANYCAST.ME
Name Server: NS200.ANYCAST.ME
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-07-08T20:00:54Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Access to Public Interest Registry WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

  REFERRER http://www.pir.org/

  REGISTRAR Public Interest Registry

SERVERS

  SERVER org.whois-servers.net

  ARGS sitew.org

  PORT 43

  TYPE domain
RegrInfo
DOMAIN

  NAME sitew.org

  HANDLE D158724931-LROR

  CREATED 2010-03-29

STATUS
clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
clientTransferProhibited https://icann.org/epp#clientTransferProhibited

NSERVER

  DNS200.ANYCAST.ME 46.105.206.200

  NS200.ANYCAST.ME 46.105.207.200

OWNER

  HANDLE C190531475-LROR

  NAME Fabien VERSANGE

  ORGANIZATION SiteW.COM

ADDRESS

STREET
12, Le puech

  CITY Calvinet

  PCODE 15340

  COUNTRY FR

  PHONE +33.471436642

  EMAIL 7wjxokme2b88uhas1ncd@d.o-w-o.info

ADMIN

  HANDLE C190531476-LROR

  NAME Fabien VERSANGE

  ORGANIZATION SiteW.COM SARL

ADDRESS

STREET
4, Place de l'Eglise

  CITY YOLET

  PCODE 15130

  COUNTRY FR

  PHONE +33.972526092

  EMAIL wpix3q0f249pt5u8nbhq@b.o-w-o.info

TECH

  HANDLE C190531476-LROR

  NAME Fabien VERSANGE

  ORGANIZATION SiteW.COM SARL

ADDRESS

STREET
4, Place de l'Eglise

  CITY YOLET

  PCODE 15130

  COUNTRY FR

  PHONE +33.972526092

  EMAIL wpix3q0f249pt5u8nbhq@b.o-w-o.info

  REGISTERED yes

Go to top

Erreurs


La liste suivante vous montre les fautes d'orthographe possibles des internautes pour le site Web recherché.

  • www.ueasygardening.com
  • www.7easygardening.com
  • www.heasygardening.com
  • www.keasygardening.com
  • www.jeasygardening.com
  • www.ieasygardening.com
  • www.8easygardening.com
  • www.yeasygardening.com
  • www.easygardeningebc.com
  • www.easygardeningebc.com
  • www.easygardening3bc.com
  • www.easygardeningwbc.com
  • www.easygardeningsbc.com
  • www.easygardening#bc.com
  • www.easygardeningdbc.com
  • www.easygardeningfbc.com
  • www.easygardening&bc.com
  • www.easygardeningrbc.com
  • www.urlw4ebc.com
  • www.easygardening4bc.com
  • www.easygardeningc.com
  • www.easygardeningbc.com
  • www.easygardeningvc.com
  • www.easygardeningvbc.com
  • www.easygardeningvc.com
  • www.easygardening c.com
  • www.easygardening bc.com
  • www.easygardening c.com
  • www.easygardeninggc.com
  • www.easygardeninggbc.com
  • www.easygardeninggc.com
  • www.easygardeningjc.com
  • www.easygardeningjbc.com
  • www.easygardeningjc.com
  • www.easygardeningnc.com
  • www.easygardeningnbc.com
  • www.easygardeningnc.com
  • www.easygardeninghc.com
  • www.easygardeninghbc.com
  • www.easygardeninghc.com
  • www.easygardening.com
  • www.easygardeningc.com
  • www.easygardeningx.com
  • www.easygardeningxc.com
  • www.easygardeningx.com
  • www.easygardeningf.com
  • www.easygardeningfc.com
  • www.easygardeningf.com
  • www.easygardeningv.com
  • www.easygardeningvc.com
  • www.easygardeningv.com
  • www.easygardeningd.com
  • www.easygardeningdc.com
  • www.easygardeningd.com
  • www.easygardeningcb.com
  • www.easygardeningcom
  • www.easygardening..com
  • www.easygardening/com
  • www.easygardening/.com
  • www.easygardening./com
  • www.easygardeningncom
  • www.easygardeningn.com
  • www.easygardening.ncom
  • www.easygardening;com
  • www.easygardening;.com
  • www.easygardening.;com
  • www.easygardeninglcom
  • www.easygardeningl.com
  • www.easygardening.lcom
  • www.easygardening com
  • www.easygardening .com
  • www.easygardening. com
  • www.easygardening,com
  • www.easygardening,.com
  • www.easygardening.,com
  • www.easygardeningmcom
  • www.easygardeningm.com
  • www.easygardening.mcom
  • www.easygardening.ccom
  • www.easygardening.om
  • www.easygardening.ccom
  • www.easygardening.xom
  • www.easygardening.xcom
  • www.easygardening.cxom
  • www.easygardening.fom
  • www.easygardening.fcom
  • www.easygardening.cfom
  • www.easygardening.vom
  • www.easygardening.vcom
  • www.easygardening.cvom
  • www.easygardening.dom
  • www.easygardening.dcom
  • www.easygardening.cdom
  • www.easygardeningc.om
  • www.easygardening.cm
  • www.easygardening.coom
  • www.easygardening.cpm
  • www.easygardening.cpom
  • www.easygardening.copm
  • www.easygardening.cim
  • www.easygardening.ciom
  • www.easygardening.coim
  • www.easygardening.ckm
  • www.easygardening.ckom
  • www.easygardening.cokm
  • www.easygardening.clm
  • www.easygardening.clom
  • www.easygardening.colm
  • www.easygardening.c0m
  • www.easygardening.c0om
  • www.easygardening.co0m
  • www.easygardening.c:m
  • www.easygardening.c:om
  • www.easygardening.co:m
  • www.easygardening.c9m
  • www.easygardening.c9om
  • www.easygardening.co9m
  • www.easygardening.ocm
  • www.easygardening.co
  • easygardening.sitew.orgm
  • www.easygardening.con
  • www.easygardening.conm
  • easygardening.sitew.orgn
  • www.easygardening.col
  • www.easygardening.colm
  • easygardening.sitew.orgl
  • www.easygardening.co
  • www.easygardening.co m
  • easygardening.sitew.org
  • www.easygardening.cok
  • www.easygardening.cokm
  • easygardening.sitew.orgk
  • www.easygardening.co,
  • www.easygardening.co,m
  • easygardening.sitew.org,
  • www.easygardening.coj
  • www.easygardening.cojm
  • easygardening.sitew.orgj
  • www.easygardening.cmo
 Afficher toutes les erreurs  Cacher toutes les erreurs